PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID e_gw1.09.00.361.1
Common NameOT_ostta09g00450
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; prasinophytes; Mamiellophyceae; Mamiellales; Bathycoccaceae; Ostreococcus
Family MYB
Protein Properties Length: 170aa    MW: 19812.4 Da    PI: 10.153
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
e_gw1.09.00.361.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.85.7e-19855148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       +g WT+eEdell +av+ + g++Wk+Ia ++  +Rt+ qc +rwqk+l
  e_gw1.09.00.361.1  8 KGGWTPEEDELLRRAVAVHNGKNWKKIAVHFSDTRTDVQCLHRWQKVL 55
                       688******************************************986 PP

2Myb_DNA-binding68.21.4e-2161107148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                        +g+WTteEd +++++v++lG+++W++Ia++++ gR +kqc++rw+++l
  e_gw1.09.00.361.1  61 KGPWTTEEDSKIIQLVTELGPKRWSKIASELP-GRIGKQCRERWYNHL 107
                        79******************************.*************97 PP

3Myb_DNA-binding54.92.1e-17113157147
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                        r  W+ eEd +l+ a++++G++ W+ Ia+ +  gRt++ +k++w++ 
  e_gw1.09.00.361.1 113 REEWSSEEDRQLILAHAEYGNR-WAEIAKSFK-GRTDNAIKNHWNST 157
                        789*******************.********9.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.689155IPR017930Myb domain
SMARTSM007179.3E-16757IPR001005SANT/Myb domain
PfamPF002491.2E-16855IPR001005SANT/Myb domain
SuperFamilySSF466894.24E-17965IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.5E-251075IPR009057Homeodomain-like
CDDcd001672.32E-111155No hitNo description
PROSITE profilePS5129431.51856111IPR017930Myb domain
SuperFamilySSF466893.27E-3158154IPR009057Homeodomain-like
SMARTSM007172.5E-1860109IPR001005SANT/Myb domain
PfamPF002491.5E-1961107IPR001005SANT/Myb domain
CDDcd001671.30E-1463107No hitNo description
Gene3DG3DSA:1.10.10.608.0E-2876115IPR009057Homeodomain-like
PROSITE profilePS5129422.484112162IPR017930Myb domain
SMARTSM007173.6E-17112160IPR001005SANT/Myb domain
PfamPF002499.7E-16113157IPR001005SANT/Myb domain
CDDcd001671.52E-11115158No hitNo description
Gene3DG3DSA:1.10.10.607.1E-23116162IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0032875Biological Processregulation of DNA endoreduplication
GO:0003677Molecular FunctionDNA binding
GO:0003713Molecular Functiontranscription coactivator activity
Sequence ? help Back to Top
Protein Sequence    Length: 170 aa     Download sequence    Send to blast
GPTRRSAKGG WTPEEDELLR RAVAVHNGKN WKKIAVHFSD TRTDVQCLHR WQKVLNPDLV  60
KGPWTTEEDS KIIQLVTELG PKRWSKIASE LPGRIGKQCR ERWYNHLDPE IKREEWSSEE  120
DRQLILAHAE YGNRWAEIAK SFKGRTDNAI KNHWNSTLKR KVDQALNQGL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C2e-6771625159MYB PROTO-ONCOGENE PROTEIN
1h89_C2e-6771625159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00505DAPTransfer from AT5G11510Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_001419697.11e-112predicted protein, partial
SwissprotQ9S7G77e-74MB3R1_ARATH; Myb-related protein 3R-1
TrEMBLA0A090N3Y51e-124A0A090N3Y5_
STRINGA4S2691e-112(Ostreococcus lucimarinus CCE9901)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP1516114
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02320.23e-78myb domain protein 3r-5
Publications ? help Back to Top
  1. Derelle E, et al.
    Genome analysis of the smallest free-living eukaryote Ostreococcus tauri unveils many unique features.
    Proc. Natl. Acad. Sci. U.S.A., 2006. 103(31): p. 11647-52
    [PMID:16868079]